PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.31158s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TCP
Protein Properties Length: 250aa    MW: 28321.8 Da    PI: 7.764
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.31158s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP90.82.9e-2842111271
                   TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssas 71 
                            g+kdrhsk++T +g+RdRR+Rls+ +a++++dLq++LG+ ++sk i+WLl+ ak  ++ l+ +++++  
  Araha.31158s0001.1.p  42 FGGKDRHSKVCTVRGLRDRRIRLSVMTAIQLYDLQERLGLSQPSKVIDWLLEVAKNDVDLLPPLQFPPGF 111
                           689************************************************************9666652 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136928.22544102IPR017887Transcription factor TCP subgroup
PfamPF036341.7E-2644143IPR005333Transcription factor, TCP
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MEEMRLREDM GIKQEDHHQK SSLSLLRQRW NNPRIVRVSR AFGGKDRHSK VCTVRGLRDR  60
RIRLSVMTAI QLYDLQERLG LSQPSKVIDW LLEVAKNDVD LLPPLQFPPG FRQLNPNLTG  120
LGESFPGVFD LGRTQRETLD LEKSKWVNLD HGFDHSDDLH FSNSIQSNKL SFPSSSSSYH  180
YNLGHLQQSL LDQSGNVTVA FSNNYNNNNL NPPAAETMSS LFPTRYPSFL GGGQLQLFCS  240
TSSQPDHIE*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00497DAPTransfer from AT5G08070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL3576120.0AL357612.1 Arabidopsis thaliana DNA chromosome 5, BAC clone T22D6 (ESSA project).
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002871306.11e-152hypothetical protein ARALYDRAFT_487639
SwissprotQ9LEZ91e-152TCP17_ARATH; Transcription factor TCP17
TrEMBLD7M1821e-152D7M182_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.6__773__AT5G08070.11e-151(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35762763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08070.11e-144TCP domain protein 17